(data stored in ACNUC30630 zone)

EMBL: AE017283.PE213

AE017283.PE213       Location/Qualifiers
FT   CDS             complement(271509..272459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0217"
FT                   /product="conserved membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81978"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR021144"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB88"
FT                   /protein_id="AAT81978.1"
FT                   /translation="MADVDDDLYAETVLHLDGHHARACIAGDHTNVFLVSRDDEVLESK
FT                   ERPAAGHVPPTAALLQGLSLAKIYDFATTVDIERIEFITEAERLNSALVDAGRDGSYGI
FT                   GEGAAILGSIDRGMASDDLCTRMTAYTAAASDARMGGAPLPAMTNSGSGNQGIVATVPV
FT                   TVAADYAGVDHERRVRALALSHAVALYAHAGLPVLSAFCAATTAAMGAAAGICLVLDGS
FT                   YSAVERAVASMTGDVVGMVCDGAGCSCALKVSASANAAGRAALLSLAGRRVPGTNGLVH
FT                   DDVDAAIRGIGRLGTEGMKQTDPEILSLMMAKQTV"
     MADVDDDLYA ETVLHLDGHH ARACIAGDHT NVFLVSRDDE VLESKERPAA GHVPPTAALL        60
     QGLSLAKIYD FATTVDIERI EFITEAERLN SALVDAGRDG SYGIGEGAAI LGSIDRGMAS       120
     DDLCTRMTAY TAAASDARMG GAPLPAMTNS GSGNQGIVAT VPVTVAADYA GVDHERRVRA       180
     LALSHAVALY AHAGLPVLSA FCAATTAAMG AAAGICLVLD GSYSAVERAV ASMTGDVVGM       240
     VCDGAGCSCA LKVSASANAA GRAALLSLAG RRVPGTNGLV HDDVDAAIRG IGRLGTEGMK       300
     QTDPEILSLM MAKQTV                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page