(data stored in ACNUC30630 zone)

EMBL: AE017283.PE226

AE017283.PE226       Location/Qualifiers
FT   CDS             282461..283438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0229"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81991"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB75"
FT                   /protein_id="AAT81991.1"
FT                   /translation="MVTRDSRLAEVVGSVAASGGVGVEVLGGREAVSRAWSRNGPLLVG
FT                   ADMAGSVMAWGLSPRSGTYVVGFDAEEAARWSAGLSASVIVVPRANQVLTEILHDELAT
FT                   TSRATVVQVNSSGGGTGVSTLASGLAWAAARSGIKVGLVELNPSAGGIDLLLGIERKDG
FT                   WRWPELASARGVTTDLGSHVPSLDGVEVVSAGRVGVHVPPAARRAVVDSLAGDHDLVVV
FT                   DPGGLDTPEVTVNVKVGVVAADLRSVMTARGQNLPDLLVARRGPGRSMPDEDIESVLGV
FT                   RPDMTIKDDRRLARGQGDGEAPWVVASRRWRSGCAELVDQVMGS"
     MVTRDSRLAE VVGSVAASGG VGVEVLGGRE AVSRAWSRNG PLLVGADMAG SVMAWGLSPR        60
     SGTYVVGFDA EEAARWSAGL SASVIVVPRA NQVLTEILHD ELATTSRATV VQVNSSGGGT       120
     GVSTLASGLA WAAARSGIKV GLVELNPSAG GIDLLLGIER KDGWRWPELA SARGVTTDLG       180
     SHVPSLDGVE VVSAGRVGVH VPPAARRAVV DSLAGDHDLV VVDPGGLDTP EVTVNVKVGV       240
     VAADLRSVMT ARGQNLPDLL VARRGPGRSM PDEDIESVLG VRPDMTIKDD RRLARGQGDG       300
     EAPWVVASRR WRSGCAELVD QVMGS                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page