(data stored in ACNUC30630 zone)

EMBL: AE017283.PE227

AE017283.PE227       Location/Qualifiers
FT   CDS             283435..284601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0230"
FT                   /product="putative secretory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0230"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81992"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB74"
FT                   /protein_id="AAT81992.1"
FT                   /translation="MSGEEPDLKLVEQVRRRLAGLARDWTPMDVAHAILDCGRVASDKT
FT                   VLAVVEELRRTSTGAGRLDPLLAMDGVTDVLVNGPNQVFIDRGQGLELTDVTFSGPEEV
FT                   RALAVRLAAAVGRRLDDGNPWVDARLPDGTRVHAVLDVLARPGTCLSLRVPSRRCLSLD
FT                   DWVTGGSMAPGCRRMIDTILSRKLAFLVTGGTGTGKTTLLSAMLTSLPSDQRLVIVEDS
FT                   REIWIDHPHWVSMEARAANSEGKGSVTLTDLVRQCLRMRPDRIVLGEVRGAELRDLLMA
FT                   LNTGHEGGCGTVHANGVAEVPARLEALAALGGLSREAASAQITAALHTVIHVERGERGR
FT                   RVAEIGVFVDVEGRAVVLPAVRWDADGVMTLGDGAGRLSQLLGMEVAR"
     MSGEEPDLKL VEQVRRRLAG LARDWTPMDV AHAILDCGRV ASDKTVLAVV EELRRTSTGA        60
     GRLDPLLAMD GVTDVLVNGP NQVFIDRGQG LELTDVTFSG PEEVRALAVR LAAAVGRRLD       120
     DGNPWVDARL PDGTRVHAVL DVLARPGTCL SLRVPSRRCL SLDDWVTGGS MAPGCRRMID       180
     TILSRKLAFL VTGGTGTGKT TLLSAMLTSL PSDQRLVIVE DSREIWIDHP HWVSMEARAA       240
     NSEGKGSVTL TDLVRQCLRM RPDRIVLGEV RGAELRDLLM ALNTGHEGGC GTVHANGVAE       300
     VPARLEALAA LGGLSREAAS AQITAALHTV IHVERGERGR RVAEIGVFVD VEGRAVVLPA       360
     VRWDADGVMT LGDGAGRLSQ LLGMEVAR                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page