(data stored in ACNUC30630 zone)

EMBL: AE017283.PE228

AE017283.PE228       Location/Qualifiers
FT   CDS             284598..285368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0231"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81993"
FT                   /db_xref="GOA:Q6AB73"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB73"
FT                   /protein_id="AAT81993.1"
FT                   /translation="MTVIGASLLMGLAVWIAMPSATRKQEGRHLPAWSGIPVGFVVAWL
FT                   LFGASGVVWAVMTVVVGEAVLVVVRRQRRRAQILKGGREVARATRALAGRVSVGEIPSV
FT                   ALEHVADDVEVLAQARRAQAVGGSVSDALIATSRQPGMAGLVPLAHAWHLAATTGAPLA
FT                   PAAKSVAEGTARRARLEATLDSELAAARASGRIMGLLPLVGLLMGHVVGAHPTVFLTTT
FT                   WLGRACLLGSTLLACVGVLWSESLADRVAKEALP"
     MTVIGASLLM GLAVWIAMPS ATRKQEGRHL PAWSGIPVGF VVAWLLFGAS GVVWAVMTVV        60
     VGEAVLVVVR RQRRRAQILK GGREVARATR ALAGRVSVGE IPSVALEHVA DDVEVLAQAR       120
     RAQAVGGSVS DALIATSRQP GMAGLVPLAH AWHLAATTGA PLAPAAKSVA EGTARRARLE       180
     ATLDSELAAA RASGRIMGLL PLVGLLMGHV VGAHPTVFLT TTWLGRACLL GSTLLACVGV       240
     LWSESLADRV AKEALP                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page