(data stored in ACNUC30630 zone)

EMBL: AE017283.PE231

AE017283.PE231       Location/Qualifiers
FT   CDS             286703..287017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0234"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81996"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB70"
FT                   /protein_id="AAT81996.1"
FT                   /translation="MTVEMAVSLIAATLVVATSCWVVGLVVVEDACRTTAAQVARQVAR
FT                   GDTASARQAESNAPTGAKVSTTTSGGWVNVTVQVDRSLGRIGPVHLRGQARSPMEPGQT
FT                   "
     MTVEMAVSLI AATLVVATSC WVVGLVVVED ACRTTAAQVA RQVARGDTAS ARQAESNAPT        60
     GAKVSTTTSG GWVNVTVQVD RSLGRIGPVH LRGQARSPME PGQT                        104
//

If you have problems or comments...

PBIL Back to PBIL home page