(data stored in ACNUC30630 zone)

EMBL: AE017283.PE233

AE017283.PE233       Location/Qualifiers
FT   CDS             287537..287773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0236"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81998"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB68"
FT                   /protein_id="AAT81998.1"
FT                   /translation="MELGRITVIPDAHRTGKLYLYRELRMVPGMAPSEVISAQAAEDDL
FT                   GQLSVTSLSVNRCESPTWGAELPRVVLGMLQGR"
     MELGRITVIP DAHRTGKLYL YRELRMVPGM APSEVISAQA AEDDLGQLSV TSLSVNRCES        60
     PTWGAELPRV VLGMLQGR                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page