(data stored in ACNUC30630 zone)

EMBL: AE017283.PE256

AE017283.PE256       Location/Qualifiers
FT   CDS             316270..316563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82021"
FT                   /db_xref="GOA:Q6AB45"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB45"
FT                   /protein_id="AAT82021.1"
FT                   /translation="MFSAVGGPAAATVGVMTGLAEGTLILAFVTPRRYRRGDEADLPVR
FT                   SRWWVPVWTVFGRSPGAGFLVFVVFFALALISGGGGIGMGDVKRAVFIGLMG"
     MFSAVGGPAA ATVGVMTGLA EGTLILAFVT PRRYRRGDEA DLPVRSRWWV PVWTVFGRSP        60
     GAGFLVFVVF FALALISGGG GIGMGDVKRA VFIGLMG                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page