(data stored in ACNUC30630 zone)

EMBL: AE017283.PE257

AE017283.PE257       Location/Qualifiers
FT   CDS             316805..317911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0263"
FT                   /product="putative outer membrane protein A"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0263"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82022"
FT                   /db_xref="GOA:Q6AB44"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB44"
FT                   /protein_id="AAT82022.1"
FT                   /translation="MWNWKMRAAGFIGGLAVVFGFVALPAHSDESVTVPVPLVDAVAVS
FT                   HYESAKRQKEKPGSVILALHAVRRLPYATVVYYSVSVDASVSGPLEDYGYLVGRGGAQA
FT                   HYSGTLSADGAVIDVGNHKLYRTIGDFQGCKMCASEWWNGAPIWEMAPGHSRLGWFSTP
FT                   PLPADVSRVDVTVANRIFHDVPVGDGLLGPTIDKEAATGRWNKGMPLGVAWPALDPKDL
FT                   AGVDVSKFVNALVTTTGDASDASRERVTKESMKIDLDASVLFDLDSDVVKPAGRQIIDR
FT                   TAKQLVARKVSGKIEVTGYTDSSGSASHNLDLSRRRAASVAKVLGSQLSKGITLVTAGK
FT                   GEADPVTSNDSEAGRRLNRRVTITVKEG"
     MWNWKMRAAG FIGGLAVVFG FVALPAHSDE SVTVPVPLVD AVAVSHYESA KRQKEKPGSV        60
     ILALHAVRRL PYATVVYYSV SVDASVSGPL EDYGYLVGRG GAQAHYSGTL SADGAVIDVG       120
     NHKLYRTIGD FQGCKMCASE WWNGAPIWEM APGHSRLGWF STPPLPADVS RVDVTVANRI       180
     FHDVPVGDGL LGPTIDKEAA TGRWNKGMPL GVAWPALDPK DLAGVDVSKF VNALVTTTGD       240
     ASDASRERVT KESMKIDLDA SVLFDLDSDV VKPAGRQIID RTAKQLVARK VSGKIEVTGY       300
     TDSSGSASHN LDLSRRRAAS VAKVLGSQLS KGITLVTAGK GEADPVTSND SEAGRRLNRR       360
     VTITVKEG                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page