(data stored in ACNUC30630 zone)

EMBL: AE017283.PE260

AE017283.PE260       Location/Qualifiers
FT   CDS             318756..319277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0266"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82025"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB41"
FT                   /protein_id="AAT82025.1"
FT                   /translation="MANNYGVSRRTLLGVGGLMLGVGLVGCSDSEEGWESVTVDRITVS
FT                   HPTEWVEKPPENENFTKNFTDGPHGMQIAGHYSDDTEPTLAWSVLEFMIRGTFQGYDPK
FT                   GYQEITVKGAARAIKCPFDFTYKGKSARGYWLVASGVLPTEGSAIVLLRLPRDDTNLVD
FT                   KIIASMSFKA"
     MANNYGVSRR TLLGVGGLML GVGLVGCSDS EEGWESVTVD RITVSHPTEW VEKPPENENF        60
     TKNFTDGPHG MQIAGHYSDD TEPTLAWSVL EFMIRGTFQG YDPKGYQEIT VKGAARAIKC       120
     PFDFTYKGKS ARGYWLVASG VLPTEGSAIV LLRLPRDDTN LVDKIIASMS FKA              173
//

If you have problems or comments...

PBIL Back to PBIL home page