(data stored in ACNUC30630 zone)

EMBL: AE017283.PE261

AE017283.PE261       Location/Qualifiers
FT   CDS             319307..319759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0267"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82026"
FT                   /db_xref="GOA:Q6AB40"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB40"
FT                   /protein_id="AAT82026.1"
FT                   /translation="MRQDTRSAWADSTLTSPAPKRRSRTFNVVLGVLLTIVAAGIADVV
FT                   VVWSCALVYDTRLGAALLGCLGALVLSHVWASRRALATVWWSCGLVLLCVVGMAVYAWV
FT                   RAGLSPVDPVVVETLAPILPVAACTAVGTGYVWRLCVRLVADHRSL"
     MRQDTRSAWA DSTLTSPAPK RRSRTFNVVL GVLLTIVAAG IADVVVVWSC ALVYDTRLGA        60
     ALLGCLGALV LSHVWASRRA LATVWWSCGL VLLCVVGMAV YAWVRAGLSP VDPVVVETLA       120
     PILPVAACTA VGTGYVWRLC VRLVADHRSL                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page