(data stored in ACNUC30630 zone)

EMBL: AE017283.PE262

AE017283.PE262       Location/Qualifiers
FT   CDS             319949..320923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0268"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82027"
FT                   /db_xref="GOA:Q6AB39"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB39"
FT                   /protein_id="AAT82027.1"
FT                   /translation="MRTRDDRGAAAPEYIAILLIAAMFTSAVAVGVKPEWVQQKVCQAL
FT                   AVIFGKGSCAPASQAKPPAQQLPKRCLIHSDENATSIYAEGKITWVTIGGEGGYGYHLV
FT                   EYSDGKADVELFYNVGASAGAAAPGWSKGPASLDASITGSAKYTKGETVHYDSVAAARA
FT                   DRDSLNKYARERALAVMHLGSAPDVPNSRLSSTSRTVEVDVKGKATLKVKAKVGGHGSA
FT                   DAGASGSVNGIVQYITKRDSKTGAVTHTVEALGSANGDAHANAGATMGNHGVKTPTVGG
FT                   HAGLDDDTSVSVTKDNSGKITELVITKSGAEGADFGVDGDFKI"
     MRTRDDRGAA APEYIAILLI AAMFTSAVAV GVKPEWVQQK VCQALAVIFG KGSCAPASQA        60
     KPPAQQLPKR CLIHSDENAT SIYAEGKITW VTIGGEGGYG YHLVEYSDGK ADVELFYNVG       120
     ASAGAAAPGW SKGPASLDAS ITGSAKYTKG ETVHYDSVAA ARADRDSLNK YARERALAVM       180
     HLGSAPDVPN SRLSSTSRTV EVDVKGKATL KVKAKVGGHG SADAGASGSV NGIVQYITKR       240
     DSKTGAVTHT VEALGSANGD AHANAGATMG NHGVKTPTVG GHAGLDDDTS VSVTKDNSGK       300
     ITELVITKSG AEGADFGVDG DFKI                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page