(data stored in ACNUC30630 zone)

EMBL: AE017283.PE275

AE017283.PE275       Location/Qualifiers
FT   CDS             332153..332923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0282"
FT                   /product="lactam utilization protein"
FT                   /note="LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0282"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82040"
FT                   /db_xref="GOA:Q6AB26"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6AB26"
FT                   /protein_id="AAT82040.1"
FT                   /translation="MATVDLNADMGESFGSWKAGDDESLLGIVTSANVACGFHAGDAVV
FT                   MGQTCKAAAEHGVCIGAHVSYRDLAGFGRNFIDVDPGRLRDEVIYQLSALRGIAAVHGA
FT                   SVRYVKPHGALYNTIVHHQAQAKAVVEAIDAVNSATGADMAILGLPGALVLDLAEQQGV
FT                   RTLSEVFADRAYNPDGTLVSRRQEGSVLHDPGEVAERVVTLVTQGSVTAIDGTKVPIKA
FT                   DSVCVHGDTPGAVAMATAVRDRLASTGIELRAAA"
     MATVDLNADM GESFGSWKAG DDESLLGIVT SANVACGFHA GDAVVMGQTC KAAAEHGVCI        60
     GAHVSYRDLA GFGRNFIDVD PGRLRDEVIY QLSALRGIAA VHGASVRYVK PHGALYNTIV       120
     HHQAQAKAVV EAIDAVNSAT GADMAILGLP GALVLDLAEQ QGVRTLSEVF ADRAYNPDGT       180
     LVSRRQEGSV LHDPGEVAER VVTLVTQGSV TAIDGTKVPI KADSVCVHGD TPGAVAMATA       240
     VRDRLASTGI ELRAAA                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page