(data stored in ACNUC30630 zone)

EMBL: AE017283.PE277

AE017283.PE277       Location/Qualifiers
FT   CDS             333537..334406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0284"
FT                   /product="allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0284"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82042"
FT                   /db_xref="GOA:Q6AB24"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB24"
FT                   /protein_id="AAT82042.1"
FT                   /translation="MTHFVVETAGPRTLIEDAGRRGWADLGISGCGAWDRRAYLDGARL
FT                   VGNGAGLGCLEILLGPVRLRCVGGPVLVAVTGADAQIDLDGAPRPSGWGFLVTDGQTVS
FT                   IAMPATGLRSYFSVTGGINASPTFASVSADPTRGMGPAPLKAGDRVSVGDGPAGLISTT
FT                   PVDIQQAPTELVLHGVWGPRDDWFTDAGRRSLEQTPWRVAQASDRVGTRLEGPSLERAV
FT                   TGELTSEPVMRGAIQVPTSGVPLVFGPDHPTTGGYPVIGVVDPEDADRLAQARAGVVVR
FT                   FAMTAHDW"
     MTHFVVETAG PRTLIEDAGR RGWADLGISG CGAWDRRAYL DGARLVGNGA GLGCLEILLG        60
     PVRLRCVGGP VLVAVTGADA QIDLDGAPRP SGWGFLVTDG QTVSIAMPAT GLRSYFSVTG       120
     GINASPTFAS VSADPTRGMG PAPLKAGDRV SVGDGPAGLI STTPVDIQQA PTELVLHGVW       180
     GPRDDWFTDA GRRSLEQTPW RVAQASDRVG TRLEGPSLER AVTGELTSEP VMRGAIQVPT       240
     SGVPLVFGPD HPTTGGYPVI GVVDPEDADR LAQARAGVVV RFAMTAHDW                   289
//

If you have problems or comments...

PBIL Back to PBIL home page