(data stored in ACNUC30630 zone)

EMBL: AE017283.PE283

AE017283.PE283       Location/Qualifiers
FT   CDS             complement(339311..340543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0290"
FT                   /product="putative two-component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0290"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82048"
FT                   /db_xref="GOA:Q6AB18"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB18"
FT                   /protein_id="AAT82048.1"
FT                   /translation="MIEYEVVGDDRRPAVWLSIVLIAIGILGCFTSTAFCPLALRMTAQ
FT                   NPSGLTVLHGVAALVADMVLPVWLLWRHRQPFTITLVTAAISLVLPIGNTVPLIALACL
FT                   LGRRRGAASWWATAAVTITTTIVGIVDAARSPKAASTIKTLLSPANTPDAADLTVSWFT
FT                   VAAFIAAGLIISIGSGLWRRTQRATTSLTRERDVAQATNAKLGDELSRREERERIAQEI
FT                   HDQLGHRLSLLSLQSGALETQLRDNPDVVKAAHEVQAGAAAAVNDLHSLLSVLTESRVT
FT                   PDLPLSKLAEVIDESFGAGQPLNSSVFIEDADRVDPAVSRAVYRIVQELLTNAAKHAPG
FT                   QTTTLRIRGNPRDGISIDATNGYIGGWAGGPSAHSRGLRGITERVELLGGSLHYGLDDN
FT                   LFHVHVDIPWQ"
     MIEYEVVGDD RRPAVWLSIV LIAIGILGCF TSTAFCPLAL RMTAQNPSGL TVLHGVAALV        60
     ADMVLPVWLL WRHRQPFTIT LVTAAISLVL PIGNTVPLIA LACLLGRRRG AASWWATAAV       120
     TITTTIVGIV DAARSPKAAS TIKTLLSPAN TPDAADLTVS WFTVAAFIAA GLIISIGSGL       180
     WRRTQRATTS LTRERDVAQA TNAKLGDELS RREERERIAQ EIHDQLGHRL SLLSLQSGAL       240
     ETQLRDNPDV VKAAHEVQAG AAAAVNDLHS LLSVLTESRV TPDLPLSKLA EVIDESFGAG       300
     QPLNSSVFIE DADRVDPAVS RAVYRIVQEL LTNAAKHAPG QTTTLRIRGN PRDGISIDAT       360
     NGYIGGWAGG PSAHSRGLRG ITERVELLGG SLHYGLDDNL FHVHVDIPWQ                  410
//

If you have problems or comments...

PBIL Back to PBIL home page