(data stored in ACNUC30630 zone)

EMBL: AE017283.PE290

AE017283.PE290       Location/Qualifiers
FT   CDS             complement(347729..349000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0298"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0298"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82055"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AB11"
FT                   /protein_id="AAT82055.1"
FT                   /translation="MSEILVIGDDLTGTNATASAYARDGLRAVTMLDPTAPVDLDDSIQ
FT                   VIACSTGSRHMTPARAAQTVDAIVRNFGYDVRAIVKRFDTTLRGNIGAEIEATLTATRA
FT                   MHPERRICGLVVPGFPAAHRTTVGGYQLLDGEPILMGPASRDPFTPVRHSGVAGIIHEQ
FT                   TQLTTTNIGLDVVMGDTSTLADRLTRAAQDAELVIVDSVTDDDQQRIATAASALESDER
FT                   SWVVFESGPFGATYAHALGIRPHVDRANPILALIGSPTELTKLQSDRLESQSGVDLITV
FT                   DDPASDVSQLLSRLRASAEIGKTVIGIRTTSRDGSAPDPLHASQMLALIIDLAVECADS
FT                   MQFDGIYASGGDVAFAVLDALGARGYEVENEVVPLAVSGKLVGGPHDGLGFATKGGLVG
FT                   DADAAVECINQLRSRIRQSEPRIV"
     MSEILVIGDD LTGTNATASA YARDGLRAVT MLDPTAPVDL DDSIQVIACS TGSRHMTPAR        60
     AAQTVDAIVR NFGYDVRAIV KRFDTTLRGN IGAEIEATLT ATRAMHPERR ICGLVVPGFP       120
     AAHRTTVGGY QLLDGEPILM GPASRDPFTP VRHSGVAGII HEQTQLTTTN IGLDVVMGDT       180
     STLADRLTRA AQDAELVIVD SVTDDDQQRI ATAASALESD ERSWVVFESG PFGATYAHAL       240
     GIRPHVDRAN PILALIGSPT ELTKLQSDRL ESQSGVDLIT VDDPASDVSQ LLSRLRASAE       300
     IGKTVIGIRT TSRDGSAPDP LHASQMLALI IDLAVECADS MQFDGIYASG GDVAFAVLDA       360
     LGARGYEVEN EVVPLAVSGK LVGGPHDGLG FATKGGLVGD ADAAVECINQ LRSRIRQSEP       420
     RIV                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page