(data stored in ACNUC30630 zone)

EMBL: AE017283.PE308

AE017283.PE308       Location/Qualifiers
FT   CDS             368971..369807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0317"
FT                   /product="conserved protein, putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0317"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82073"
FT                   /db_xref="GOA:Q6AAZ3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAZ3"
FT                   /protein_id="AAT82073.1"
FT                   /translation="MMRNNTSTLGPRRCLDERPRRGMMRDRAADRRLLWETMFVLAVSL
FT                   GQSAWYSILRMIERLTRGVPMNQQTSTLNSSVTPGRPWLDLLYQLSDIAFGVVPALLAV
FT                   LLLAQVKPPRQGVRRALGLEAPGWGRDVGAGAMLAAIIGIPGLGFYWAAHALGFNTTVR
FT                   AADLQHVWWTAPVLIGLAGMNAVLEETVMIGYLFTRWGQIGWSTTMVIVTSAIIRGTYH
FT                   LYQGWGDFIGNIVMGLFLGWVFSRRCRLLPLIVAHAFLDIVSFLGYAYLAGRVSWL"
     MMRNNTSTLG PRRCLDERPR RGMMRDRAAD RRLLWETMFV LAVSLGQSAW YSILRMIERL        60
     TRGVPMNQQT STLNSSVTPG RPWLDLLYQL SDIAFGVVPA LLAVLLLAQV KPPRQGVRRA       120
     LGLEAPGWGR DVGAGAMLAA IIGIPGLGFY WAAHALGFNT TVRAADLQHV WWTAPVLIGL       180
     AGMNAVLEET VMIGYLFTRW GQIGWSTTMV IVTSAIIRGT YHLYQGWGDF IGNIVMGLFL       240
     GWVFSRRCRL LPLIVAHAFL DIVSFLGYAY LAGRVSWL                               278
//

If you have problems or comments...

PBIL Back to PBIL home page