(data stored in ACNUC30630 zone)

EMBL: AE017283.PE316

AE017283.PE316       Location/Qualifiers
FT   CDS             375422..376183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0326"
FT                   /product="cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0326"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82081"
FT                   /db_xref="GOA:Q6AAY5"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAY5"
FT                   /protein_id="AAT82081.1"
FT                   /translation="MTPLDLGSWAAGALTGSMAGAIPVAVFAGLLSFFSPCVLPLIPGY
FT                   LSYVTGLGAADVIEGQRRARTVVGTVLFVVGFTVVFVATGTIIGTLGKVLVGHRRAIEI
FT                   IVGALTVVLGAMFAGLVPLGRRELRIHRLPRAGLAAAPILGIVFGLGWTPCIGPALSVV
FT                   YGLSLTQGSAVRGAVLAICYSLGLGIPFIAAAAAVVWMGRTIDAMRTHQHGVQRFGGIL
FT                   LMTVGVLLVTGWWESIMAMLRAWAAKFGAVI"
     MTPLDLGSWA AGALTGSMAG AIPVAVFAGL LSFFSPCVLP LIPGYLSYVT GLGAADVIEG        60
     QRRARTVVGT VLFVVGFTVV FVATGTIIGT LGKVLVGHRR AIEIIVGALT VVLGAMFAGL       120
     VPLGRRELRI HRLPRAGLAA APILGIVFGL GWTPCIGPAL SVVYGLSLTQ GSAVRGAVLA       180
     ICYSLGLGIP FIAAAAAVVW MGRTIDAMRT HQHGVQRFGG ILLMTVGVLL VTGWWESIMA       240
     MLRAWAAKFG AVI                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page