(data stored in ACNUC30630 zone)

EMBL: AE017283.PE317

AE017283.PE317       Location/Qualifiers
FT   CDS             376261..377772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0327"
FT                   /product="conserved protein, putative c-type cytochrome
FT                   biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0327"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82082"
FT                   /db_xref="GOA:Q6AAY4"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAY4"
FT                   /protein_id="AAT82082.1"
FT                   /translation="MRWVWGQLTSMRTALILLFLLALAAIPGSVVPQSAQSAMKVSDFA
FT                   ANHPTLDRICRPLGMYHVYTSVWFSAIYLLLLISLIGCIVPRIVSHAKALRRQPPRVPA
FT                   RLDRLAAHASMITSASAVEVSQRAQQWLTSHRYRFVVDDDGSLRAEAGRHRETGNLVFH
FT                   IFLVFVLVGVGWNTLWGFKGTSVVVEGQGFSNSITQYDEFKAGAMVDTDNLTPFSMKLR
FT                   KFVVSFETGTVQRGAARSFDATVDLTMGGKTQTRDLQVNHPLRIGSTKVHLLGHGYAAD
FT                   VVVRDGDGKVAYSGPVVFLPQDANFKSVGVIKVPDARPDRLAFQGFFLPTGAITAGGPT
FT                   SLFPDALNPQLYLTAWYGKPTVETGVPSNIYTLDTTGLTQVTNGKDKARFVLSPGQRYK
FT                   LPDGKGSIQFNGWQRWAKIQVSQNPGLPLTFLSVVLSVAGLCVSLFSRSRRVWVRTIPG
FT                   DDGLRVEIGGLDRSDSRSGAVDDVNSLLAALHGDSMSGDVGEEHS"
     MRWVWGQLTS MRTALILLFL LALAAIPGSV VPQSAQSAMK VSDFAANHPT LDRICRPLGM        60
     YHVYTSVWFS AIYLLLLISL IGCIVPRIVS HAKALRRQPP RVPARLDRLA AHASMITSAS       120
     AVEVSQRAQQ WLTSHRYRFV VDDDGSLRAE AGRHRETGNL VFHIFLVFVL VGVGWNTLWG       180
     FKGTSVVVEG QGFSNSITQY DEFKAGAMVD TDNLTPFSMK LRKFVVSFET GTVQRGAARS       240
     FDATVDLTMG GKTQTRDLQV NHPLRIGSTK VHLLGHGYAA DVVVRDGDGK VAYSGPVVFL       300
     PQDANFKSVG VIKVPDARPD RLAFQGFFLP TGAITAGGPT SLFPDALNPQ LYLTAWYGKP       360
     TVETGVPSNI YTLDTTGLTQ VTNGKDKARF VLSPGQRYKL PDGKGSIQFN GWQRWAKIQV       420
     SQNPGLPLTF LSVVLSVAGL CVSLFSRSRR VWVRTIPGDD GLRVEIGGLD RSDSRSGAVD       480
     DVNSLLAALH GDSMSGDVGE EHS                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page