(data stored in ACNUC30630 zone)

EMBL: AE017283.PE318

AE017283.PE318       Location/Qualifiers
FT   CDS             377769..378650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0328"
FT                   /product="putative cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0328"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82083"
FT                   /db_xref="GOA:Q6AAY3"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAY3"
FT                   /protein_id="AAT82083.1"
FT                   /translation="MSVENLSAVGIVTAAVLYMLAFLAHAVEWASVRGTEHPSHEERLR
FT                   SETWGRMGLNLTVLGAACAAIGVVCRGIAAHRLPWGNMYEFVTSALFFVVIAYLVLVAI
FT                   HHVRWMGIAVTLLLAVGNGLAATVFYVAVAPLVPALHSVWFVIHIVAACIAAAALNVGA
FT                   IASIMYLIATNAQAKAQRTGVLVAKLPPLESMDALAYRAHAIGFPIWTFTIAAGSVWAD
FT                   YAWGRFWGWDPKETWSLVTWVVYAAYLHARSTAGWRGRRAALIAIVGAACFWFNFVGVN
FT                   LIFNGLHSYAGI"
     MSVENLSAVG IVTAAVLYML AFLAHAVEWA SVRGTEHPSH EERLRSETWG RMGLNLTVLG        60
     AACAAIGVVC RGIAAHRLPW GNMYEFVTSA LFFVVIAYLV LVAIHHVRWM GIAVTLLLAV       120
     GNGLAATVFY VAVAPLVPAL HSVWFVIHIV AACIAAAALN VGAIASIMYL IATNAQAKAQ       180
     RTGVLVAKLP PLESMDALAY RAHAIGFPIW TFTIAAGSVW ADYAWGRFWG WDPKETWSLV       240
     TWVVYAAYLH ARSTAGWRGR RAALIAIVGA ACFWFNFVGV NLIFNGLHSY AGI              293
//

If you have problems or comments...

PBIL Back to PBIL home page