(data stored in ACNUC30630 zone)

EMBL: AE017283.PE329

AE017283.PE329       Location/Qualifiers
FT   CDS             complement(389673..390599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0339"
FT                   /product="phosphate transport system permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0339"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82094"
FT                   /db_xref="GOA:Q6AAX2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAX2"
FT                   /protein_id="AAT82094.1"
FT                   /translation="MSATTPDHITHHGDNTPGQLDLSRPSGKRTIKSGCASAFMIVATV
FT                   LAVIPLAWLLFAAVRRGIGSLFHASWWTHSMDPSFDLAEQGAIHAIVGTLEIGLITSII
FT                   SVPIALMTAIFLVEYARGTKIAKVISFAVDVLTGVPSIVAALFVFAVVVTTFGGTQSAW
FT                   ASSLALMILMVPTVLRSTEEMLKLVPDSLREASFALGVSQWKTIMKVVLPTSMTGILTG
FT                   IVLGLARVMGETAPLIVLLQFNTELTFNPSTPNFATLPTVITNAYTQGGVDTPVVWGAA
FT                   ITLIILVMGLNLIARRISRRYMRRMGK"
     MSATTPDHIT HHGDNTPGQL DLSRPSGKRT IKSGCASAFM IVATVLAVIP LAWLLFAAVR        60
     RGIGSLFHAS WWTHSMDPSF DLAEQGAIHA IVGTLEIGLI TSIISVPIAL MTAIFLVEYA       120
     RGTKIAKVIS FAVDVLTGVP SIVAALFVFA VVVTTFGGTQ SAWASSLALM ILMVPTVLRS       180
     TEEMLKLVPD SLREASFALG VSQWKTIMKV VLPTSMTGIL TGIVLGLARV MGETAPLIVL       240
     LQFNTELTFN PSTPNFATLP TVITNAYTQG GVDTPVVWGA AITLIILVMG LNLIARRISR       300
     RYMRRMGK                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page