(data stored in ACNUC30630 zone)

EMBL: AE017283.PE338

AE017283.PE338       Location/Qualifiers
FT   CDS             399015..399956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0348"
FT                   /product="conserved protein, putative glycine cleavage
FT                   T-protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0348"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82103"
FT                   /db_xref="GOA:Q6AAW3"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAW3"
FT                   /protein_id="AAT82103.1"
FT                   /translation="MSDPVLLTDGPDTGLVSHMRNPIAEQRLMVDGGGSVELSNREVLA
FT                   ISGVDRLGWLHSLTSQFLDGMEPGRTTTSLVLSPTGHVEHVLHGVDDGQTFWAWTEPGR
FT                   GADLAAWLDSMRFMMRVEVALRPDMTVRWFGHDVAVSDGVVLDSEVAGGHEVILPVDAE
FT                   IPGDADPVGVLAWEALRIAAGIPRIGLDTDDRTIPNEIGLYGTHMDKGCYRGQETVARV
FT                   YNLGRPPRRLTLLQLDGSRAELPEVGADIHAGGRRVGAMGSSANHGVDGPIGLALVRRG
FT                   VDVGLELEVDGIAAGQQPLVDPEVGLHVCPVV"
     MSDPVLLTDG PDTGLVSHMR NPIAEQRLMV DGGGSVELSN REVLAISGVD RLGWLHSLTS        60
     QFLDGMEPGR TTTSLVLSPT GHVEHVLHGV DDGQTFWAWT EPGRGADLAA WLDSMRFMMR       120
     VEVALRPDMT VRWFGHDVAV SDGVVLDSEV AGGHEVILPV DAEIPGDADP VGVLAWEALR       180
     IAAGIPRIGL DTDDRTIPNE IGLYGTHMDK GCYRGQETVA RVYNLGRPPR RLTLLQLDGS       240
     RAELPEVGAD IHAGGRRVGA MGSSANHGVD GPIGLALVRR GVDVGLELEV DGIAAGQQPL       300
     VDPEVGLHVC PVV                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page