(data stored in ACNUC30630 zone)

EMBL: AE017283.PE342

AE017283.PE342       Location/Qualifiers
FT   CDS             complement(403896..404162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0352"
FT                   /product="phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0352"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82107"
FT                   /db_xref="GOA:Q6AAV9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAV9"
FT                   /protein_id="AAT82107.1"
FT                   /translation="MPSRTTTIAAESGLHARPAAMFVQAASKSGLAVKIGRPGEEPVDA
FT                   RSILSVMGLGAKHGETVELTAEGDNADEVLDALVANLQTDPEA"
     MPSRTTTIAA ESGLHARPAA MFVQAASKSG LAVKIGRPGE EPVDARSILS VMGLGAKHGE        60
     TVELTAEGDN ADEVLDALVA NLQTDPEA                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page