(data stored in ACNUC30630 zone)

EMBL: AE017283.PE37

AE017283.PE37        Location/Qualifiers
FT   CDS             39966..40847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0042"
FT                   /product="membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0042"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81802"
FT                   /db_xref="GOA:Q6ABJ6"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABJ6"
FT                   /protein_id="AAT81802.1"
FT                   /translation="MGMNAAIAALLGGLLVGGVVMVGIGIAPIHQLSTGQSTSLWTRVD
FT                   NWFSRLPRRSRVHGLTGLGIGVVGYVVTEWAVVLVIVPVLAVVVPALLADPPRHDLDVM
FT                   RALERWVRLVSGSASTGKSVIDAIRATRRQAPELLIEPLTRVVARLDSRWDTRAALQGL
FT                   ADDLDSADADQVIAAIMMAAERGGTGATGTLDALAASLQERIRAAREIRVERAKPRVVV
FT                   RQVSIIIGVVLAGALILGREYLVPYRTGVGQLLLCCYAGLYLAGLIALSRRSKPRRRAR
FT                   ILLRRAGEANYG"
     MGMNAAIAAL LGGLLVGGVV MVGIGIAPIH QLSTGQSTSL WTRVDNWFSR LPRRSRVHGL        60
     TGLGIGVVGY VVTEWAVVLV IVPVLAVVVP ALLADPPRHD LDVMRALERW VRLVSGSAST       120
     GKSVIDAIRA TRRQAPELLI EPLTRVVARL DSRWDTRAAL QGLADDLDSA DADQVIAAIM       180
     MAAERGGTGA TGTLDALAAS LQERIRAARE IRVERAKPRV VVRQVSIIIG VVLAGALILG       240
     REYLVPYRTG VGQLLLCCYA GLYLAGLIAL SRRSKPRRRA RILLRRAGEA NYG              293
//

If you have problems or comments...

PBIL Back to PBIL home page