(data stored in ACNUC30630 zone)

EMBL: AE017283.PE38

AE017283.PE38        Location/Qualifiers
FT   CDS             40840..41742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0043"
FT                   /product="membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0043"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81803"
FT                   /db_xref="GOA:Q6ABJ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABJ5"
FT                   /protein_id="AAT81803.1"
FT                   /translation="MAESTVILAAICGALLACAPVFVVSGRRNAPLRLSDALAGLSDYG
FT                   RQDAVVGPVAEGGRLERWGTRAAIRWPRMVSERSRRTLILQGRTPGDLVIEKAVMAMGG
FT                   MLVPALARAVAAACGDTLPVTPVGLAVVLAVVGWFIPDTRIRSRSKAVRQDAAEAVLVY
FT                   VDLVTLARLANQSAPRALVEAAQMSDHPVLARIRMTLERSRLEQQSPWAGLDELSDELD
FT                   LPELAELVEVLRLDDQGASLAGALRARVHEMRDAHLNQEKVEAQTASESLTIWMVIPVL
FT                   VLGLVLITPPLLIMAGVAS"
     MAESTVILAA ICGALLACAP VFVVSGRRNA PLRLSDALAG LSDYGRQDAV VGPVAEGGRL        60
     ERWGTRAAIR WPRMVSERSR RTLILQGRTP GDLVIEKAVM AMGGMLVPAL ARAVAAACGD       120
     TLPVTPVGLA VVLAVVGWFI PDTRIRSRSK AVRQDAAEAV LVYVDLVTLA RLANQSAPRA       180
     LVEAAQMSDH PVLARIRMTL ERSRLEQQSP WAGLDELSDE LDLPELAELV EVLRLDDQGA       240
     SLAGALRARV HEMRDAHLNQ EKVEAQTASE SLTIWMVIPV LVLGLVLITP PLLIMAGVAS       300
//

If you have problems or comments...

PBIL Back to PBIL home page