(data stored in ACNUC30630 zone)

EMBL: AE017283.PE394

AE017283.PE394       Location/Qualifiers
FT   CDS             453574..454374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0408"
FT                   /product="hypothetical membrane protein (DedA family)"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0408"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82159"
FT                   /db_xref="GOA:Q6AAQ7"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAQ7"
FT                   /protein_id="AAT82159.1"
FT                   /translation="MQNEMSTAAAGEKDSFAVAATSLAVAEDELARSSTGTESSAEEEW
FT                   WKAEGMPWNHKPGRSDYWCMGWIGFLGIFSLAMLPLRGWLLGLDPPILMGLTGSRTGAA
FT                   ATGALASVGQAPYWLWWLLLGSIMSIKLDWVYWWAGKLWGRGMIEVWAGRSERAHRRYD
FT                   QAEKWARKLGWLGVLVAYVPIPLPIMPVVFVLTGASGMKVRWFIALDFVAATIWNLGYL
FT                   GLGWGVGDPIVDALKYYAKIANWVAIALIIVILAPIFVKKKQKA"
     MQNEMSTAAA GEKDSFAVAA TSLAVAEDEL ARSSTGTESS AEEEWWKAEG MPWNHKPGRS        60
     DYWCMGWIGF LGIFSLAMLP LRGWLLGLDP PILMGLTGSR TGAAATGALA SVGQAPYWLW       120
     WLLLGSIMSI KLDWVYWWAG KLWGRGMIEV WAGRSERAHR RYDQAEKWAR KLGWLGVLVA       180
     YVPIPLPIMP VVFVLTGASG MKVRWFIALD FVAATIWNLG YLGLGWGVGD PIVDALKYYA       240
     KIANWVAIAL IIVILAPIFV KKKQKA                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page