(data stored in ACNUC30630 zone)

EMBL: AE017283.PE398

AE017283.PE398       Location/Qualifiers
FT   CDS             456507..457520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0412"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82163"
FT                   /db_xref="GOA:Q6AAQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAQ3"
FT                   /protein_id="AAT82163.1"
FT                   /translation="MSWPSCDIEGWWLQSCRFETGAMDKPAIEIRDLVKSFPQTGSRER
FT                   LIAVDHLSMTINRGEVVAFLGPNGAGKSTTVDMLLGMTRPDSGKVSVLGSDPRTAARTG
FT                   CISAVFQTGGLLPDFTVAETMKAIAAAHGQRSRVKPLIERWELAPFAGTKVGKCSGGQR
FT                   QRLRFALAMLPKPDVLILDEPTTGLDVEARRHFWQVMGEEADAGRTVIFATHYIEEADS
FT                   FARRVVLVSGGQLVADGPINEVRASVSGSIVRATLTDPSGLAEGLHTFPGINDVTVRGQ
FT                   QLIVHTSQPDDLARYLLAHTDAHGLLISTTTLEDAFVRLTGSNDSRDDADDWEAAA"
     MSWPSCDIEG WWLQSCRFET GAMDKPAIEI RDLVKSFPQT GSRERLIAVD HLSMTINRGE        60
     VVAFLGPNGA GKSTTVDMLL GMTRPDSGKV SVLGSDPRTA ARTGCISAVF QTGGLLPDFT       120
     VAETMKAIAA AHGQRSRVKP LIERWELAPF AGTKVGKCSG GQRQRLRFAL AMLPKPDVLI       180
     LDEPTTGLDV EARRHFWQVM GEEADAGRTV IFATHYIEEA DSFARRVVLV SGGQLVADGP       240
     INEVRASVSG SIVRATLTDP SGLAEGLHTF PGINDVTVRG QQLIVHTSQP DDLARYLLAH       300
     TDAHGLLIST TTLEDAFVRL TGSNDSRDDA DDWEAAA                                337
//

If you have problems or comments...

PBIL Back to PBIL home page