(data stored in ACNUC30630 zone)

EMBL: AE017283.PE409

AE017283.PE409       Location/Qualifiers
FT   CDS             465566..468136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0422"
FT                   /product="tetrapyrrole methylase, putative CbiE/G/H fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82174"
FT                   /db_xref="GOA:Q6AAP2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAP2"
FT                   /protein_id="AAT82174.1"
FT                   /translation="MIRVHGYLGTISDALREEVTQADLVVGGQRHLDALAVPDDKRQKL
FT                   GLIGPAIERIQSLPDDANVVVIASGDPLFFGVVRRIRQAGLRVEVVTAPTSLQAAFAAV
FT                   ALPWDDAQFVSSHSKDIETAVRLAKIHPKVGVLTAPNRGLAELVDGLAGRGKTFVLAEK
FT                   IGEEGQRVRVLDEDAAKAVIADEDILSPNVVLVLEHHPDSPEALGINPELAGDVNVNGP
FT                   DDPQPGSDTNPDGSDRDPIIGQIINSDAAVAHAEAIDRALKRETKKYVGPSRTGLAAAW
FT                   GECDLIVSHLALGATTRIIAPLLESKKTDPGVVVVDEAGRFAIPLVGGHVGGANELSRT
FT                   VAEALSGTAVVSTATDSLGVPALDQLGWAYEGDVAGVTGSIIAGRPVLVVREQPWPLPP
FT                   LPQNVTEDVETPAARVIVSERVAERVFVDHGDDLPTVVLHPSCLVVGMGCNKGTEVESL
FT                   RQLLVKTLEDNGLALGSVTRLVSHEVKAGELGLVKLANQLGVEYRTESAEALAAHDVPT
FT                   PSDVVAREVGTPSVSEAAVLCQGAELLVHKTKTSEATCAIGRIPARGHLSVVGLGPGSR
FT                   DLLTPRAVEAIRNATFVAGYAPYVRQIRDLVRPGATILATKMGTEEERTQAAIEATRDG
FT                   RNVAFVCGGDPAIYAMASPTLEMGTDGIDVEIVPGVTAELAISAILGAPLGHDHATISL
FT                   SDLHTDWDLILKRVKAAAEGDLVTTFYNPRSRTRTHQLPDALAIMAEHRPPSTPVALVS
FT                   HAERRQQQVIMSTLEEFKPEWCGMTTLVVVGSTTTKYVSSGDGRRLMVTPRDYHWMDGH
FT                   VCSEARKNYTHKDLPKADEETYLSKPPVHSTRMSEPINDTKDSK"
     MIRVHGYLGT ISDALREEVT QADLVVGGQR HLDALAVPDD KRQKLGLIGP AIERIQSLPD        60
     DANVVVIASG DPLFFGVVRR IRQAGLRVEV VTAPTSLQAA FAAVALPWDD AQFVSSHSKD       120
     IETAVRLAKI HPKVGVLTAP NRGLAELVDG LAGRGKTFVL AEKIGEEGQR VRVLDEDAAK       180
     AVIADEDILS PNVVLVLEHH PDSPEALGIN PELAGDVNVN GPDDPQPGSD TNPDGSDRDP       240
     IIGQIINSDA AVAHAEAIDR ALKRETKKYV GPSRTGLAAA WGECDLIVSH LALGATTRII       300
     APLLESKKTD PGVVVVDEAG RFAIPLVGGH VGGANELSRT VAEALSGTAV VSTATDSLGV       360
     PALDQLGWAY EGDVAGVTGS IIAGRPVLVV REQPWPLPPL PQNVTEDVET PAARVIVSER       420
     VAERVFVDHG DDLPTVVLHP SCLVVGMGCN KGTEVESLRQ LLVKTLEDNG LALGSVTRLV       480
     SHEVKAGELG LVKLANQLGV EYRTESAEAL AAHDVPTPSD VVAREVGTPS VSEAAVLCQG       540
     AELLVHKTKT SEATCAIGRI PARGHLSVVG LGPGSRDLLT PRAVEAIRNA TFVAGYAPYV       600
     RQIRDLVRPG ATILATKMGT EEERTQAAIE ATRDGRNVAF VCGGDPAIYA MASPTLEMGT       660
     DGIDVEIVPG VTAELAISAI LGAPLGHDHA TISLSDLHTD WDLILKRVKA AAEGDLVTTF       720
     YNPRSRTRTH QLPDALAIMA EHRPPSTPVA LVSHAERRQQ QVIMSTLEEF KPEWCGMTTL       780
     VVVGSTTTKY VSSGDGRRLM VTPRDYHWMD GHVCSEARKN YTHKDLPKAD EETYLSKPPV       840
     HSTRMSEPIN DTKDSK                                                       856
//

If you have problems or comments...

PBIL Back to PBIL home page