(data stored in ACNUC30630 zone)

EMBL: AE017283.PE418

AE017283.PE418       Location/Qualifiers
FT   CDS             476237..476920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0430"
FT                   /product="cobalt transport protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82183"
FT                   /db_xref="GOA:Q6AAN3"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAN3"
FT                   /protein_id="AAT82183.1"
FT                   /translation="MHIAEGVLSPAQCAVWYAAAAPFVVHGGYRVVKEVKEHPENKLLL
FT                   ATAGAFTFVLSAIKLPSVTGSSSHPTGTGVGAALFKPPVMAFLGMIVLIFQALLLAHGG
FT                   ISTLGANTFSMAIAGPWAGYAFYKLTKKLRGPDALAIFLCMVFSDFITYVVTSFQLAFA
FT                   FPDATGGFWGAVGKFLGIFAITQVPLALIEGLVGILLFRFLAKVAAPQLKQLGVLDDNP
FT                   EVAHA"
     MHIAEGVLSP AQCAVWYAAA APFVVHGGYR VVKEVKEHPE NKLLLATAGA FTFVLSAIKL        60
     PSVTGSSSHP TGTGVGAALF KPPVMAFLGM IVLIFQALLL AHGGISTLGA NTFSMAIAGP       120
     WAGYAFYKLT KKLRGPDALA IFLCMVFSDF ITYVVTSFQL AFAFPDATGG FWGAVGKFLG       180
     IFAITQVPLA LIEGLVGILL FRFLAKVAAP QLKQLGVLDD NPEVAHA                     227
//

If you have problems or comments...

PBIL Back to PBIL home page