(data stored in ACNUC30630 zone)

EMBL: AE017283.PE419

AE017283.PE419       Location/Qualifiers
FT   CDS             476913..477347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0432"
FT                   /product="putative cobalt transport protein CbiN"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0432"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82184"
FT                   /db_xref="GOA:Q6AAN2"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAN2"
FT                   /protein_id="AAT82184.1"
FT                   /translation="MPENTVAKAHRDSSLTSKSKWVTPVIIVLVVGLFIISMVLGAKKT
FT                   SGGEEGFGGTDDAAAEAAEKAGAKKWIKPIFEPNSSEVESGLFALQAALGAGIVGYALG
FT                   RMSGRTKGREEAERASDLNSVDDVPQAAVTSSEDTSTSKS"
     MPENTVAKAH RDSSLTSKSK WVTPVIIVLV VGLFIISMVL GAKKTSGGEE GFGGTDDAAA        60
     EAAEKAGAKK WIKPIFEPNS SEVESGLFAL QAALGAGIVG YALGRMSGRT KGREEAERAS       120
     DLNSVDDVPQ AAVTSSEDTS TSKS                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page