(data stored in ACNUC30630 zone)

EMBL: AE017283.PE446

AE017283.PE446       Location/Qualifiers
FT   CDS             504802..506700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0459"
FT                   /product="thiamine pyrophosphate-requiring enzyme, putative
FT                   acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0459"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82211"
FT                   /db_xref="GOA:Q6AAK5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAK5"
FT                   /protein_id="AAT82211.1"
FT                   /translation="MTEQTVRLSVGQAIVRYLTHQYTERDGVERRFIRGVFGIFGHGNA
FT                   TGLGQALLQNEAAPDDEEGRLEYWMGRNEQGMVHACSAYARATNRLQALAATASIGPGS
FT                   LNMVTGAALATTNRVPVLLFPSDIFANRAPDPVLQQLEDPTNPDVSCNDAFRPVSKFWD
FT                   RVNRPEQLMVSLPRAMRVLTDPVDTGAAVICLPEDVQTEVYDWPVSFFAKKVWYIDRRL
FT                   PDRAAVVRAAQAIRAARCPLIISGGGTIYSEASQELRDFASATGIPVADTQAGKGAINW
FT                   DHPCAVGGVGATGSDSANALAAQADLIIGIGTRYSDFTTGSQTAFKNPDVTFVNVNVGA
FT                   FDAAKQGAQMLVADAREALTALSKELDGYRVPQEWSDLASAKAKAWAEVTDRCYHLGHG
FT                   PLPAQTEVFGALNELMGDDDVVINAAGSMPGDLQCLWRASTPVQYHVEYAFSCMGYEIP
FT                   ASLGVKMALPDSEVVAIVGDGTYQMLPMELATIVQEGAKVILVLLQNYGFASIGALSES
FT                   HGSQRFGTKYRQHDDGQGHVVGDDALLPLDIAANARSWGIDVLEVRTIKEFREAYRKAE
FT                   ASDHATMIHIETDLYGPNPPASGWWDVPVTSQSRLKSTQKAYAEYTGQVAAQRRFF"
     MTEQTVRLSV GQAIVRYLTH QYTERDGVER RFIRGVFGIF GHGNATGLGQ ALLQNEAAPD        60
     DEEGRLEYWM GRNEQGMVHA CSAYARATNR LQALAATASI GPGSLNMVTG AALATTNRVP       120
     VLLFPSDIFA NRAPDPVLQQ LEDPTNPDVS CNDAFRPVSK FWDRVNRPEQ LMVSLPRAMR       180
     VLTDPVDTGA AVICLPEDVQ TEVYDWPVSF FAKKVWYIDR RLPDRAAVVR AAQAIRAARC       240
     PLIISGGGTI YSEASQELRD FASATGIPVA DTQAGKGAIN WDHPCAVGGV GATGSDSANA       300
     LAAQADLIIG IGTRYSDFTT GSQTAFKNPD VTFVNVNVGA FDAAKQGAQM LVADAREALT       360
     ALSKELDGYR VPQEWSDLAS AKAKAWAEVT DRCYHLGHGP LPAQTEVFGA LNELMGDDDV       420
     VINAAGSMPG DLQCLWRAST PVQYHVEYAF SCMGYEIPAS LGVKMALPDS EVVAIVGDGT       480
     YQMLPMELAT IVQEGAKVIL VLLQNYGFAS IGALSESHGS QRFGTKYRQH DDGQGHVVGD       540
     DALLPLDIAA NARSWGIDVL EVRTIKEFRE AYRKAEASDH ATMIHIETDL YGPNPPASGW       600
     WDVPVTSQSR LKSTQKAYAE YTGQVAAQRR FF                                     632
//

If you have problems or comments...

PBIL Back to PBIL home page