(data stored in ACNUC30630 zone)

EMBL: AE017283.PE486

AE017283.PE486       Location/Qualifiers
FT   CDS             complement(548485..548970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0498"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82251"
FT                   /db_xref="GOA:Q6AAG5"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAG5"
FT                   /protein_id="AAT82251.1"
FT                   /translation="MTSHPFTHLRGNGSAHMVDVTTKTPTVRVATAECCVVCSEPIMTA
FT                   LRDESVPKGDVLAVARIAGIQATKHTPDLIPLAHRIGVHGAEVDLWLEPDRVRIRATTR
FT                   TTDRTGVEMEALTAVTVAALTVADMVKGVDRGFAIEHAVITHKAGGRSGEWTRSDDQ"
     MTSHPFTHLR GNGSAHMVDV TTKTPTVRVA TAECCVVCSE PIMTALRDES VPKGDVLAVA        60
     RIAGIQATKH TPDLIPLAHR IGVHGAEVDL WLEPDRVRIR ATTRTTDRTG VEMEALTAVT       120
     VAALTVADMV KGVDRGFAIE HAVITHKAGG RSGEWTRSDD Q                           161
//

If you have problems or comments...

PBIL Back to PBIL home page