(data stored in ACNUC30630 zone)

EMBL: AE017283.PE491

AE017283.PE491       Location/Qualifiers
FT   CDS             552215..552643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0503"
FT                   /product="putative molybdopterin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0503"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82256"
FT                   /db_xref="GOA:Q6AAG0"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAG0"
FT                   /protein_id="AAT82256.1"
FT                   /translation="MSIMSPHPPSHRVSDVAALLGVSDDTVRRWIDQRHVRAAKDTTGR
FT                   LRVDGASLAAFLVTQQQERQDLADGAQTQSMRNHIRGIVAKVISDKVMSQVELVTGNLS
FT                   IVSLVSTEAVRELGLQVGSIAVAQVKATNVSLQLPVTR"
     MSIMSPHPPS HRVSDVAALL GVSDDTVRRW IDQRHVRAAK DTTGRLRVDG ASLAAFLVTQ        60
     QQERQDLADG AQTQSMRNHI RGIVAKVISD KVMSQVELVT GNLSIVSLVS TEAVRELGLQ       120
     VGSIAVAQVK ATNVSLQLPV TR                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page