(data stored in ACNUC30630 zone)

EMBL: AE017283.PE50

AE017283.PE50        Location/Qualifiers
FT   CDS             complement(55356..55967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0056"
FT                   /product="hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0056"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81815"
FT                   /db_xref="GOA:Q6ABR8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABR8"
FT                   /protein_id="AAT81815.1"
FT                   /translation="MLRFARTCLWSFTASQQELRFMCGVTLDDRDMKYYYAVLTHGITR
FT                   KLDILLLTVAVALGFFGLDAWVILPESHTPLVKSLGIPAASWLVALILGLILRPFPTKL
FT                   TGKVDANAMEAAIAKKTIMAFCGMTWPALILFVLAFLLYLPRSFVLLAMIAHGATLFLL
FT                   LHSTDQRLEQFAETWCGDHYDPANPEIDTFLHGTRSVSFD"
     MLRFARTCLW SFTASQQELR FMCGVTLDDR DMKYYYAVLT HGITRKLDIL LLTVAVALGF        60
     FGLDAWVILP ESHTPLVKSL GIPAASWLVA LILGLILRPF PTKLTGKVDA NAMEAAIAKK       120
     TIMAFCGMTW PALILFVLAF LLYLPRSFVL LAMIAHGATL FLLLHSTDQR LEQFAETWCG       180
     DHYDPANPEI DTFLHGTRSV SFD                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page