(data stored in ACNUC30630 zone)

EMBL: AE017283.PE549

AE017283.PE549       Location/Qualifiers
FT   CDS             619028..620254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0559"
FT                   /product="membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0559"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82314"
FT                   /db_xref="GOA:Q6AAA2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAA2"
FT                   /protein_id="AAT82314.1"
FT                   /translation="MKLFSSGRKTPTSSPASSHAGAMDETVGVTSTSEAANVATQPVPT
FT                   PVEDVPNGVRTAAGWCWRMIVIAAFIYGLYQVLHAASEVSVPVAVALMLTAAMWPLANW
FT                   LSRHHIHRGIASGICLLLLVILVGGVFTLVGAQIALQWRQLGDQSVASFKQALQWLAKS
FT                   PLHTNEAQLTHLMQKAEAAMAGSQGRIASTAAAAGSQIGRFGAGLVMALFATFFFVYEG
FT                   DKLAEKSAVLIPREHRAAILDAAKRGWVALVAYVRAAVIVAFVDGLGAGIGAAIIGSSM
FT                   SVAIGALTFILAFVPIVGALTAGVVAVGVVLVTLGFFKAFIMLIVFVAVMQIEGHVLQP
FT                   FLLGKAVSIHPLIVLLGIAVGAIISGIVGALFAIPIVAFGVAFIKALNPETPANEVPPN
FT                   HDDLAAEHT"
     MKLFSSGRKT PTSSPASSHA GAMDETVGVT STSEAANVAT QPVPTPVEDV PNGVRTAAGW        60
     CWRMIVIAAF IYGLYQVLHA ASEVSVPVAV ALMLTAAMWP LANWLSRHHI HRGIASGICL       120
     LLLVILVGGV FTLVGAQIAL QWRQLGDQSV ASFKQALQWL AKSPLHTNEA QLTHLMQKAE       180
     AAMAGSQGRI ASTAAAAGSQ IGRFGAGLVM ALFATFFFVY EGDKLAEKSA VLIPREHRAA       240
     ILDAAKRGWV ALVAYVRAAV IVAFVDGLGA GIGAAIIGSS MSVAIGALTF ILAFVPIVGA       300
     LTAGVVAVGV VLVTLGFFKA FIMLIVFVAV MQIEGHVLQP FLLGKAVSIH PLIVLLGIAV       360
     GAIISGIVGA LFAIPIVAFG VAFIKALNPE TPANEVPPNH DDLAAEHT                    408
//

If you have problems or comments...

PBIL Back to PBIL home page