(data stored in ACNUC30630 zone)

EMBL: AE017283.PE561

AE017283.PE561       Location/Qualifiers
FT   CDS             complement(631516..632787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0571"
FT                   /product="protein with WD40 domain"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82326"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA90"
FT                   /protein_id="AAT82326.1"
FT                   /translation="MPFLFPKFWVMSAPHDTHVSRRLRRGLASACAVVTAIAAFSPAHA
FT                   APSPNKAGPMSGSTGRTTVGQLLTPAGQLTTLGDLPLNEALSPDGRYLIVSNNGQGTQS
FT                   LQVIKTATGKVVQTIPYKSPESLYMGLAFSPDGTHLFASAAGNHKIRTYHFDCGKLVET
FT                   SAIQMPVVSPKLTKVNLYPAGLAVTNDSKRLVVADQLADAVSVIDLATNKIQTTHIGHR
FT                   PVWVTLSKDSTKAFVSSQGGADVAEVDITKSQPLATHKINVGFHPNKSVLTPDGKSLYV
FT                   ANGDADTISVVDVASHRQTATIPVNRNGSKLVGANPTGLALSQDGKRLYVTNSGHNEVA
FT                   VINAATRKVIGDIPTGWYPTQVLAHDGKLSITSAKGLGAGPNNGPGHPNPTDPRDTAEN
FT                   QYSGSMIKGLLSTVNGMTQRPWPS"
     MPFLFPKFWV MSAPHDTHVS RRLRRGLASA CAVVTAIAAF SPAHAAPSPN KAGPMSGSTG        60
     RTTVGQLLTP AGQLTTLGDL PLNEALSPDG RYLIVSNNGQ GTQSLQVIKT ATGKVVQTIP       120
     YKSPESLYMG LAFSPDGTHL FASAAGNHKI RTYHFDCGKL VETSAIQMPV VSPKLTKVNL       180
     YPAGLAVTND SKRLVVADQL ADAVSVIDLA TNKIQTTHIG HRPVWVTLSK DSTKAFVSSQ       240
     GGADVAEVDI TKSQPLATHK INVGFHPNKS VLTPDGKSLY VANGDADTIS VVDVASHRQT       300
     ATIPVNRNGS KLVGANPTGL ALSQDGKRLY VTNSGHNEVA VINAATRKVI GDIPTGWYPT       360
     QVLAHDGKLS ITSAKGLGAG PNNGPGHPNP TDPRDTAENQ YSGSMIKGLL STVNGMTQRP       420
     WPS                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page