(data stored in ACNUC30630 zone)

EMBL: AE017283.PE608

AE017283.PE608       Location/Qualifiers
FT   CDS             complement(679498..680415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0617"
FT                   /product="solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0617"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82373"
FT                   /db_xref="GOA:Q6AA43"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA43"
FT                   /protein_id="AAT82373.1"
FT                   /translation="MHRHLLAIATLSACALAMAGCSNSGPDSGSGPSASSDKVDVVAST
FT                   NVWGSVAQAIGGDKVNVHSIIDSPDQDPHDYEATAKDKLAFSKAKIAITNGGGYDDWAT
FT                   KLVKSTSPQADFIDAVETSGLKKPGDKEFNEHVFYSIDSVRKVAKVVESDLVKTSPDNK
FT                   STFETNLKDFESKLTDLKARATKVGKKHPHSTAIATEPVAGYLLEDMKIKNITPDEFVE
FT                   QSETEAGPSTKVVHETTDLLTQKKASILLVNGQTSDDVTKALQKAASKANVHEVGVWET
FT                   FPEGVDNYPDFIGKAIDSIDKGLA"
     MHRHLLAIAT LSACALAMAG CSNSGPDSGS GPSASSDKVD VVASTNVWGS VAQAIGGDKV        60
     NVHSIIDSPD QDPHDYEATA KDKLAFSKAK IAITNGGGYD DWATKLVKST SPQADFIDAV       120
     ETSGLKKPGD KEFNEHVFYS IDSVRKVAKV VESDLVKTSP DNKSTFETNL KDFESKLTDL       180
     KARATKVGKK HPHSTAIATE PVAGYLLEDM KIKNITPDEF VEQSETEAGP STKVVHETTD       240
     LLTQKKASIL LVNGQTSDDV TKALQKAASK ANVHEVGVWE TFPEGVDNYP DFIGKAIDSI       300
     DKGLA                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page