(data stored in ACNUC30630 zone)

EMBL: AE017283.PE636

AE017283.PE636       Location/Qualifiers
FT   CDS             complement(709853..711013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0645"
FT                   /product="ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0645"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82401"
FT                   /db_xref="GOA:Q6AA15"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA15"
FT                   /protein_id="AAT82401.1"
FT                   /translation="MSTENPVVKAIADALSHVNDPEIKRPITDLNMIDEITVDEQGRAF
FT                   VRILLTVAGCPLKTELREQATEAVRSVDGVTSVSVELGTMTDEQRDALKVQLRGDVPER
FT                   VIPFAQPGNTTKVIAVSSGKGGVGKSSVTVNLALALAQLGREVGLLDADIYGHSVPDML
FT                   GLGDAHPTPLDDMLLPVPGLGIKSISIGMMKPNKSDVIAWRGPILDRALTQLLADVHWG
FT                   DLDYLLIDLPPGTGDIAMSLGQKLPNAEVLVVTTPQQAASEVAERAGTMAGIMQQRVLG
FT                   VVENMSWLEVTAPKSRETFRVELFGTGGGQKAADALSERLGTTIPLLGQIPLDVELRSG
FT                   GDDGDPIVITHPDSPAAEAITELAKTIDARPRGLVGINLGVQPVSH"
     MSTENPVVKA IADALSHVND PEIKRPITDL NMIDEITVDE QGRAFVRILL TVAGCPLKTE        60
     LREQATEAVR SVDGVTSVSV ELGTMTDEQR DALKVQLRGD VPERVIPFAQ PGNTTKVIAV       120
     SSGKGGVGKS SVTVNLALAL AQLGREVGLL DADIYGHSVP DMLGLGDAHP TPLDDMLLPV       180
     PGLGIKSISI GMMKPNKSDV IAWRGPILDR ALTQLLADVH WGDLDYLLID LPPGTGDIAM       240
     SLGQKLPNAE VLVVTTPQQA ASEVAERAGT MAGIMQQRVL GVVENMSWLE VTAPKSRETF       300
     RVELFGTGGG QKAADALSER LGTTIPLLGQ IPLDVELRSG GDDGDPIVIT HPDSPAAEAI       360
     TELAKTIDAR PRGLVGINLG VQPVSH                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page