(data stored in ACNUC30630 zone)

EMBL: AE017283.PE640

AE017283.PE640       Location/Qualifiers
FT   CDS             713577..714449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0649"
FT                   /product="putative cytochrome oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0649"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82405"
FT                   /db_xref="GOA:Q6AA11"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA11"
FT                   /protein_id="AAT82405.1"
FT                   /translation="MANTVTTRNAVPRGVVVLFAVTAVAITVTLALGSTVCATDASASC
FT                   PNWPGCYVGRLTPLDATQPWVEFIHRVISASVGLFALASVIVGMVYRHADKLLAALPIV
FT                   ALLGALTSGVFGMMTIKWGINSVEASFDLLAAIISMGAMWRAYFVARKPRSSWRWNGRT
FT                   KLGIGAVAFLVIGHFFAVQVAGCGSLTRCMGWAMFVRGAGDGPFAGWIAQQAIMGIGML
FT                   LAIVSLVARWGRRNGWDILCAVFIVIELVVGVLIAVNGSSHGLGTLHAIPAVLILCLTM
FT                   TATMRSARG"
     MANTVTTRNA VPRGVVVLFA VTAVAITVTL ALGSTVCATD ASASCPNWPG CYVGRLTPLD        60
     ATQPWVEFIH RVISASVGLF ALASVIVGMV YRHADKLLAA LPIVALLGAL TSGVFGMMTI       120
     KWGINSVEAS FDLLAAIISM GAMWRAYFVA RKPRSSWRWN GRTKLGIGAV AFLVIGHFFA       180
     VQVAGCGSLT RCMGWAMFVR GAGDGPFAGW IAQQAIMGIG MLLAIVSLVA RWGRRNGWDI       240
     LCAVFIVIEL VVGVLIAVNG SSHGLGTLHA IPAVLILCLT MTATMRSARG                  290
//

If you have problems or comments...

PBIL Back to PBIL home page