(data stored in ACNUC30630 zone)

EMBL: AE017283.PE654

AE017283.PE654       Location/Qualifiers
FT   CDS             complement(728027..728896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0663"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82419"
FT                   /db_xref="GOA:Q6A9Z7"
FT                   /db_xref="InterPro:IPR018929"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Z7"
FT                   /protein_id="AAT82419.1"
FT                   /translation="MASGPQAGWYRDPDGTPDRYRWFDGERWTDRTTTSPDPAPQHSGK
FT                   GHREHDNGRSSSWLWAIIIVILVVAVVVAFALHRSTSSDHNAEPDLNSSSPTVSAWNEK
FT                   STTPSASSSAVTCPRGQHPGNQDSNDGRLHGGGVSVESIPNWRHENLTLPWVMGQSAQI
FT                   DDVYPGWMSVSGVGGLPVAEGFSDPQTAATMMMDCFASSDYYAGYTGEKEIRSEALTID
FT                   GHPAWWKRSEVYVSLPSLPQVRGDVVDVVVVNTGQTDFLGMYFNSATIGDSTRQTLVDH
FT                   ARQSLKVD"
     MASGPQAGWY RDPDGTPDRY RWFDGERWTD RTTTSPDPAP QHSGKGHREH DNGRSSSWLW        60
     AIIIVILVVA VVVAFALHRS TSSDHNAEPD LNSSSPTVSA WNEKSTTPSA SSSAVTCPRG       120
     QHPGNQDSND GRLHGGGVSV ESIPNWRHEN LTLPWVMGQS AQIDDVYPGW MSVSGVGGLP       180
     VAEGFSDPQT AATMMMDCFA SSDYYAGYTG EKEIRSEALT IDGHPAWWKR SEVYVSLPSL       240
     PQVRGDVVDV VVVNTGQTDF LGMYFNSATI GDSTRQTLVD HARQSLKVD                   289
//

If you have problems or comments...

PBIL Back to PBIL home page