(data stored in ACNUC30630 zone)

EMBL: AE017283.PE658

AE017283.PE658       Location/Qualifiers
FT   CDS             complement(734198..735520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0667"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0667"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82423"
FT                   /db_xref="GOA:Q6A9Z3"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Z3"
FT                   /protein_id="AAT82423.1"
FT                   /translation="MTSTDPHDYRDDIRHDREFVNDTEAVIRLGSMLLSSGTGSYRVKR
FT                   AMCDAGLALGIDRLDASVSLTEITATAHRGDNFRTVAREVYRVRVDSSRIAALEDLAHN
FT                   LPAGTTGRELESRLDYISRTVRPKWAEWQTVLAGGVACAGFAILNKFSLADSLVVLAAA
FT                   SVGQFVRGRLNRRWLNQFGVAALASAAACLIYLMLADLLTNTGLHTIHGPGYVASLLFL
FT                   VPGFPMITSILDMVRMDFTAGLSRATYSVGLILAATMSAWVFSAATGLQPLPAQTVFPY
FT                   PWAWFAYAVATACGVAGFAILFNSSPCTVAWAAALGACGNLCRLALVGVNLPAQLAAGV
FT                   GGIVIGFLASPLSVRTKLPRITLTVPACVIMVPGASMYRTVYWLNGQDMTKALTFGVDA
FT                   VLTVILIACGLAVARMCTDPAWARNLPVPSPHAFKFSEDNH"
     MTSTDPHDYR DDIRHDREFV NDTEAVIRLG SMLLSSGTGS YRVKRAMCDA GLALGIDRLD        60
     ASVSLTEITA TAHRGDNFRT VAREVYRVRV DSSRIAALED LAHNLPAGTT GRELESRLDY       120
     ISRTVRPKWA EWQTVLAGGV ACAGFAILNK FSLADSLVVL AAASVGQFVR GRLNRRWLNQ       180
     FGVAALASAA ACLIYLMLAD LLTNTGLHTI HGPGYVASLL FLVPGFPMIT SILDMVRMDF       240
     TAGLSRATYS VGLILAATMS AWVFSAATGL QPLPAQTVFP YPWAWFAYAV ATACGVAGFA       300
     ILFNSSPCTV AWAAALGACG NLCRLALVGV NLPAQLAAGV GGIVIGFLAS PLSVRTKLPR       360
     ITLTVPACVI MVPGASMYRT VYWLNGQDMT KALTFGVDAV LTVILIACGL AVARMCTDPA       420
     WARNLPVPSP HAFKFSEDNH                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page