(data stored in ACNUC30630 zone)

EMBL: AE017283.PE661

AE017283.PE661       Location/Qualifiers
FT   CDS             737973..738608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0670"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82426"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Z0"
FT                   /protein_id="AAT82426.1"
FT                   /translation="MAVVAAVAAIVGCSRTTPAVPEAVVPTSSVTSTPRYSPLSQASAT
FT                   PQRMTSATSQRVTNVGGAQGALTCRRGEKAAMAFSDVDAALGARITVLTIRNCGSSVMI
FT                   LPVMPQLRQITEAGARVPVAWQPYDPKARSKRLAPGKVTSWELSWHSNGDCEHRGAWRL
FT                   EAKVGTTTAMLVGCLDLGSSYALTGESSTGPGGSDAVPVPEAAVRWSD"
     MAVVAAVAAI VGCSRTTPAV PEAVVPTSSV TSTPRYSPLS QASATPQRMT SATSQRVTNV        60
     GGAQGALTCR RGEKAAMAFS DVDAALGARI TVLTIRNCGS SVMILPVMPQ LRQITEAGAR       120
     VPVAWQPYDP KARSKRLAPG KVTSWELSWH SNGDCEHRGA WRLEAKVGTT TAMLVGCLDL       180
     GSSYALTGES STGPGGSDAV PVPEAAVRWS D                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page