(data stored in ACNUC30630 zone)

EMBL: AE017283.PE671

AE017283.PE671       Location/Qualifiers
FT   CDS             745628..746395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0680"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82436"
FT                   /db_xref="GOA:Q6A9Y0"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Y0"
FT                   /protein_id="AAT82436.1"
FT                   /translation="MLRRVTRSSWETHSSPGIRPGSLRVAAVRSARSSSSTLPAEGSVT
FT                   PLLPGSGLPAAINCSSGWTFLSRMPMSVPSTTDRARRHPEVAALVGVVAGIFSAIVKFG
FT                   WEVPFPPRTPERNATNPPQQLLEQLGFSDHFAHTLVYFNGNGLPVMSFIIHFGFAIFFG
FT                   VAYCVGAERFPKITLWQGVAFGVVVYVVFHVIVMPGLGTVPAPWHQPWQEHLSELLGHI
FT                   VWMWSIEVVRRDLRSRITGEPDPWVEPSMTAGR"
     MLRRVTRSSW ETHSSPGIRP GSLRVAAVRS ARSSSSTLPA EGSVTPLLPG SGLPAAINCS        60
     SGWTFLSRMP MSVPSTTDRA RRHPEVAALV GVVAGIFSAI VKFGWEVPFP PRTPERNATN       120
     PPQQLLEQLG FSDHFAHTLV YFNGNGLPVM SFIIHFGFAI FFGVAYCVGA ERFPKITLWQ       180
     GVAFGVVVYV VFHVIVMPGL GTVPAPWHQP WQEHLSELLG HIVWMWSIEV VRRDLRSRIT       240
     GEPDPWVEPS MTAGR                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page