(data stored in ACNUC30630 zone)

EMBL: AE017283.PE70

AE017283.PE70        Location/Qualifiers
FT   CDS             81438..82250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0075"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81835"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABL9"
FT                   /protein_id="AAT81835.1"
FT                   /translation="MQGGGMEIIDYFGLWEHDRSCDPQRRTLEEEREFWRCYARVYDQH
FT                   AGETGGSLAQIAAVTEIVEPGSSVLDVGGGTGRFAIPLAQRGCRVTVLDRSEDMLSVLE
FT                   SSAEEKDVEIDVVHQEWPADLGCQFDSVMAAWSLYWNLDLQASLQAMVRQTKKHLIIID
FT                   TTGSPTVWDHALAVARGGGIVASQARHLLFAGGLAQLGIPAEIRVLEEYRVIGETELER
FT                   EIDAHGGSKVAAMEYLDTHAVRIRSGWRYKRTVGLIHAQGKNIPARNL"
     MQGGGMEIID YFGLWEHDRS CDPQRRTLEE EREFWRCYAR VYDQHAGETG GSLAQIAAVT        60
     EIVEPGSSVL DVGGGTGRFA IPLAQRGCRV TVLDRSEDML SVLESSAEEK DVEIDVVHQE       120
     WPADLGCQFD SVMAAWSLYW NLDLQASLQA MVRQTKKHLI IIDTTGSPTV WDHALAVARG       180
     GGIVASQARH LLFAGGLAQL GIPAEIRVLE EYRVIGETEL EREIDAHGGS KVAAMEYLDT       240
     HAVRIRSGWR YKRTVGLIHA QGKNIPARNL                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page