(data stored in ACNUC30630 zone)

EMBL: AE017283.PE75

AE017283.PE75        Location/Qualifiers
FT   CDS             86995..88281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0080"
FT                   /product="chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81840"
FT                   /db_xref="GOA:Q6ABP4"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABP4"
FT                   /protein_id="AAT81840.1"
FT                   /translation="MVTSRIRFVAAVVLTGLASGLIGGLTSELSHLIEVCAFGVPFSSS
FT                   TTGVGEVVMWRRLVAPIMGALIAGLTWRWLRPFPSGSITSVRQAIDSPTRLRPVETIVD
FT                   ALAQLVVVGSGSSLGREAAPRQMAALAAQGLSDTFRVDVATRRVVLASAAGAGLASVYN
FT                   VPVAGALYALELTVRPDLRTKRGWGQVGIAGVISVLSTVTAWLLNHDRPIYRSPAATVT
FT                   GPGLGWMVLVVAVSTVVGAGMGVLFGEMKRRVPVTSRLWWTVPLGSAGVTAIALAAPQV
FT                   VGNGQVIVNLVLAHPVAPASLVILLVGKILATTVALRSGAAGGLLTPSLSAGALVGALV
FT                   AVVAGIDAPSQIAMMVIVGAGCVLSMTQRAPLFAAAFALELTRAGALGIPVVVAAVMLG
FT                   WTGFVLVSRRGLGLHGRIGRAPGHTSDPR"
     MVTSRIRFVA AVVLTGLASG LIGGLTSELS HLIEVCAFGV PFSSSTTGVG EVVMWRRLVA        60
     PIMGALIAGL TWRWLRPFPS GSITSVRQAI DSPTRLRPVE TIVDALAQLV VVGSGSSLGR       120
     EAAPRQMAAL AAQGLSDTFR VDVATRRVVL ASAAGAGLAS VYNVPVAGAL YALELTVRPD       180
     LRTKRGWGQV GIAGVISVLS TVTAWLLNHD RPIYRSPAAT VTGPGLGWMV LVVAVSTVVG       240
     AGMGVLFGEM KRRVPVTSRL WWTVPLGSAG VTAIALAAPQ VVGNGQVIVN LVLAHPVAPA       300
     SLVILLVGKI LATTVALRSG AAGGLLTPSL SAGALVGALV AVVAGIDAPS QIAMMVIVGA       360
     GCVLSMTQRA PLFAAAFALE LTRAGALGIP VVVAAVMLGW TGFVLVSRRG LGLHGRIGRA       420
     PGHTSDPR                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page