(data stored in ACNUC30630 zone)

EMBL: AE017283.PE81

AE017283.PE81        Location/Qualifiers
FT   CDS             97276..98211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0086"
FT                   /product="putative permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0086"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81846"
FT                   /db_xref="GOA:Q6ABK9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABK9"
FT                   /protein_id="AAT81846.1"
FT                   /translation="MTLPIATVPAGRRARRRTPMGGGGPFAALCILPALVLYVLFLVYP
FT                   TLNVFHMSLFDWNGLGNAPSFIGLDNFAALIHDPAFVRAFENTLFILVVVTIVTICSSI
FT                   FIAAVLTRETLVGAGWYRFVLYLPSVLSIVVVAAIFSAVFDQNNGLVNGLLQALGLGHG
FT                   PVWLGDQNVVMYSVAIAMVWQSLGYYVVLYMAGMSSVPVEIYESASLDGAGRMTQLGSI
FT                   TIPLIWSNIRTTLTFFVLSSVNLAFVLVKALTDGGPNGSLEVLLNYMYKQAFTNSAYGY
FT                   GMAIGVVTFLFSFLVAMLISHVTRREVLQY"
     MTLPIATVPA GRRARRRTPM GGGGPFAALC ILPALVLYVL FLVYPTLNVF HMSLFDWNGL        60
     GNAPSFIGLD NFAALIHDPA FVRAFENTLF ILVVVTIVTI CSSIFIAAVL TRETLVGAGW       120
     YRFVLYLPSV LSIVVVAAIF SAVFDQNNGL VNGLLQALGL GHGPVWLGDQ NVVMYSVAIA       180
     MVWQSLGYYV VLYMAGMSSV PVEIYESASL DGAGRMTQLG SITIPLIWSN IRTTLTFFVL       240
     SSVNLAFVLV KALTDGGPNG SLEVLLNYMY KQAFTNSAYG YGMAIGVVTF LFSFLVAMLI       300
     SHVTRREVLQ Y                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page