(data stored in ACNUC30630 zone)

EMBL: AE017283.PE87

AE017283.PE87        Location/Qualifiers
FT   CDS             complement(104633..107374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0092"
FT                   /product="conserved membrane protein"
FT                   /note="Cu-oxidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0092"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81852"
FT                   /db_xref="GOA:Q6ABN0"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABN0"
FT                   /protein_id="AAT81852.1"
FT                   /translation="MPEITSAPVGRKPDTNKRSWHRKASRPVSGWLVALLIVAVANPWI
FT                   PQSRWLLVHMVTLGVATTSIMVWGQYFTEAILHNNLTDTDRSRQVLRIRLLAVGIVITC
FT                   IGMVVTWPWITVTGAAVIGSTLTWYAFALGHQVRHALPGRFDSTVWFYCAAACLLPLGA
FT                   TLGAIMAFSPTEPWRTRLLVAHQALNLLGFVGLTVVGTLITLWPTVLRTKMQPAQDRHG
FT                   KISLCVMFVAVAATTTGALCRLWWLAALGVTAHIVGICIVLGDLVACAAHEPPRDFPGF
FT                   TMGAAICWMLVWLAWLAWKLASNGTRLLADDIFTLSVPVIVGFLLQLLIGAMSYLMPMV
FT                   MGGGPKIVRATNAKMHAYGALRATITNAGLLLWVLAMGTWTRRIGMVLTVVGLATFLPA
FT                   TAAMVRTGVPMLKEKGRQMAARKAASEKGEAPDPDNGPAQAAPVASLDRSATSKPAEPA
FT                   PTAPPDRRSFVGAFAGLATALTAAAVGHHLDQTTLTNDTNGSAAVVGHVAPTGHTTTVN
FT                   ITAKGMKYHPSTITVPAGDQLVVEITNKDPNQVHDLQFANGAHSSRLAPGDHATVKVGV
FT                   ITGPTEGWCTVVGHKSMGMVLDVQVDGMSGVHDRDDHVDSADPRRRIDLTKAPGKDFRT
FT                   RDAVLPPLMTGRVHRMTLIAQESVQEIAPETTIDAMTYNGRYMAPVIHARIGDEIRVHL
FT                   VNRGTMGHSLDFHAGTVSPTRVMRTIAPGQELDYNFTLHRAGIWLYHCSTAPMSAHIAA
FT                   GMFGAVIVPPHDLPRADREFYLVQSETYLSEHNGAEVNTAKIANETPDLTMFNGHANQY
FT                   VFEPLKARVGGRVRIWVLAAGPSRGCSFHVVGTQFDTVFKEGAYTLKRGNPEGGGCQAL
FT                   DLASAQGGFVEMVFEEPGRYTFVNHSFVEMERGAKGFIEVTT"
     MPEITSAPVG RKPDTNKRSW HRKASRPVSG WLVALLIVAV ANPWIPQSRW LLVHMVTLGV        60
     ATTSIMVWGQ YFTEAILHNN LTDTDRSRQV LRIRLLAVGI VITCIGMVVT WPWITVTGAA       120
     VIGSTLTWYA FALGHQVRHA LPGRFDSTVW FYCAAACLLP LGATLGAIMA FSPTEPWRTR       180
     LLVAHQALNL LGFVGLTVVG TLITLWPTVL RTKMQPAQDR HGKISLCVMF VAVAATTTGA       240
     LCRLWWLAAL GVTAHIVGIC IVLGDLVACA AHEPPRDFPG FTMGAAICWM LVWLAWLAWK       300
     LASNGTRLLA DDIFTLSVPV IVGFLLQLLI GAMSYLMPMV MGGGPKIVRA TNAKMHAYGA       360
     LRATITNAGL LLWVLAMGTW TRRIGMVLTV VGLATFLPAT AAMVRTGVPM LKEKGRQMAA       420
     RKAASEKGEA PDPDNGPAQA APVASLDRSA TSKPAEPAPT APPDRRSFVG AFAGLATALT       480
     AAAVGHHLDQ TTLTNDTNGS AAVVGHVAPT GHTTTVNITA KGMKYHPSTI TVPAGDQLVV       540
     EITNKDPNQV HDLQFANGAH SSRLAPGDHA TVKVGVITGP TEGWCTVVGH KSMGMVLDVQ       600
     VDGMSGVHDR DDHVDSADPR RRIDLTKAPG KDFRTRDAVL PPLMTGRVHR MTLIAQESVQ       660
     EIAPETTIDA MTYNGRYMAP VIHARIGDEI RVHLVNRGTM GHSLDFHAGT VSPTRVMRTI       720
     APGQELDYNF TLHRAGIWLY HCSTAPMSAH IAAGMFGAVI VPPHDLPRAD REFYLVQSET       780
     YLSEHNGAEV NTAKIANETP DLTMFNGHAN QYVFEPLKAR VGGRVRIWVL AAGPSRGCSF       840
     HVVGTQFDTV FKEGAYTLKR GNPEGGGCQA LDLASAQGGF VEMVFEEPGR YTFVNHSFVE       900
     MERGAKGFIE VTT                                                          913
//

If you have problems or comments...

PBIL Back to PBIL home page