(data stored in ACNUC32233 zone)

EMBL: AF026488.PE2

AF026488.PE2         Location/Qualifiers
FT   CDS             join(<1..530,824..1057)
FT                   /codon_start=3
FT                   /gene="SPTBN2"
FT                   /product="beta III spectrin"
FT                   /note="membrane skeletal protein; beta spectrin
FT                   nonerythroid form 2"
FT                   /db_xref="GOA:O15020"
FT                   /db_xref="H-InvDB:HIT000062824.12"
FT                   /db_xref="HGNC:HGNC:11276"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016343"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="PDB:1WJM"
FT                   /db_xref="PDB:1WYQ"
FT                   /db_xref="PDB:6ANU"
FT                   /db_xref="UniProtKB/Swiss-Prot:O15020"
FT                   /protein_id="AAC79503.1"
FT                   /translation="SVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGER
FT                   QTRTRGPAPSAMPQSRSTESAHAATLPPRGPEPSAQEQMEGMLCRKQEMEAFGKKAANR
FT                   SWQNVYCVLRRGSLGFYKDAKAASAGVPYHGEVPVSLARAQGSVAFDYRKRKHVFKLGL
FT                   QDGKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPVVPSTTRGMTRAMTMPPVS
FT                   PVGAEGPVVLRSKDGREREREKRFSFFKKNK"
     SVNGVCTDGE PSQPLLGQQR LEHSSFPEGP GPGSGDEANG PRGERQTRTR GPAPSAMPQS        60
     RSTESAHAAT LPPRGPEPSA QEQMEGMLCR KQEMEAFGKK AANRSWQNVY CVLRRGSLGF       120
     YKDAKAASAG VPYHGEVPVS LARAQGSVAF DYRKRKHVFK LGLQDGKEYL FQAKDEAEMS       180
     SWLRVVNAAI ATASSASGEP EEPVVPSTTR GMTRAMTMPP VSPVGAEGPV VLRSKDGRER       240
     EREKRFSFFK KNK                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page