(data stored in ACNUC7421 zone)

EMBL: AF117227.ILVH

AF117227.ILVH        Location/Qualifiers
FT   CDS             complement(1403..1897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="ilv"
FT                   /gene="ilvH"
FT                   /product="IlvH"
FT                   /note="acetohydroxy acid synthase III, small subunit"
FT                   /db_xref="GOA:P21622"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21622"
FT                   /protein_id="AAF65177.1"
FT                   /translation="MMRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLS
FT                   RMTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGREEVKR
FT                   NTEIFRGQIIDVTPTLYTVQLAGTSDKLDAFLASLRDVAKIVEVARSGVVGLSRGDKIM
FT                   R"
     MMRRILSVLL ENESGALSRV IGLFSQRGYN IESLTVAPTD DPTLSRMTIQ TVGDEKVLEQ        60
     IEKQLHKLVD VLRVSELGQG AHVEREIMLV KIQASGYGRE EVKRNTEIFR GQIIDVTPTL       120
     YTVQLAGTSD KLDAFLASLR DVAKIVEVAR SGVVGLSRGD KIMR                        164
//

If you have problems or comments...

PBIL Back to PBIL home page