(data stored in ACNUC32233 zone)

EMBL: AF203696

AF203696             Location/Qualifiers
FT   CDS             <1..>396
FT                   /codon_start=3
FT                   /product="BIV spectrin"
FT                   /note="cytoskeletal protein"
FT                   /db_xref="GOA:Q9EQM0"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="MGI:MGI:1890574"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EQM0"
FT                   /protein_id="AAG35643.1"
FT                   /translation="KPELAASVRKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQS
FT                   FAELDKRLLHMESQLQDVDPGGDLATVNSQLKKLQSMESQVEEWCREVGELQAQTAALP
FT                   LEQASKELVGERQSAVGERLVRLLEPL"
     KPELAASVRK KLGEIRQCWA ELESTTQAKA RQLFEASKAD QLVQSFAELD KRLLHMESQL        60
     QDVDPGGDLA TVNSQLKKLQ SMESQVEEWC REVGELQAQT AALPLEQASK ELVGERQSAV       120
     GERLVRLLEP L                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page