(data stored in ACNUC7820 zone)

EMBL: AF271052

AF271052             Location/Qualifiers
FT   CDS             <1..>399
FT                   /codon_start=1
FT                   /product="odorant receptor"
FT                   /note="similar to mT15m"
FT                   /db_xref="GOA:P35899"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35899"
FT                   /protein_id="AAG21325.1"
FT                   /translation="LCGLLVLGSWVTTALNSLLQSSMALRLSFCTDLKIPHFVCELNQL
FT                   VLLACNDTFPNDMVMYFAAVLLGGGPLAGILYSYSKIVSSIRAISSSQGKYKAFSTCAS
FT                   HLSVVSLFYSTLLGVYLSSSFTQNSHSTA"
     LCGLLVLGSW VTTALNSLLQ SSMALRLSFC TDLKIPHFVC ELNQLVLLAC NDTFPNDMVM        60
     YFAAVLLGGG PLAGILYSYS KIVSSIRAIS SSQGKYKAFS TCASHLSVVS LFYSTLLGVY       120
     LSSSFTQNSH STA                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page